PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.14G138700.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 341aa    MW: 37841.2 Da    PI: 5.622
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.14G138700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox231.4e-072913232254
                          SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                           +yp++e++++L +++gL+ +q+ +WF N+R +
  Manes.14G138700.2.p 291 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 323
                          59*****************************87 PP

2ELK29.22.1e-10244265122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          ELKh+L+++Y+++++++++E++
  Manes.14G138700.2.p 244 ELKHELKQGYKEKIVDIREEIL 265
                          9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.5E-1879123IPR005540KNOX1
PfamPF037904.0E-1781122IPR005540KNOX1
SMARTSM012569.7E-27132187IPR005541KNOX2
PfamPF037918.6E-19136186IPR005541KNOX2
SMARTSM011886.1E-4244265IPR005539ELK domain
PROSITE profilePS512139.969244264IPR005539ELK domain
PfamPF037897.5E-7244265IPR005539ELK domain
PROSITE profilePS5007111.677264327IPR001356Homeobox domain
SuperFamilySSF466895.13E-16266329IPR009057Homeodomain-like
SMARTSM003897.0E-11266331IPR001356Homeobox domain
CDDcd000862.13E-11267328No hitNo description
Gene3DG3DSA:1.10.10.603.5E-25271328IPR009057Homeodomain-like
PfamPF059208.8E-18284323IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MAFQDHISHE ITFQSPLSAS ASSSTSAGPA WLSNAVLRLN DDVLGRSRSE KAGLNNSNNG  60
GEDELMDGGG GGGDNWERAK YKAEILGHPL YDQLLAAHVA CLRIATPVDQ LARIDAQLAQ  120
SQEVVAKYSV LGNGQVVDEK ELDQFMTQYV LLLCSFKDQL QQHVRVHAME AVMACWELEQ  180
SLQSLTGASL GEGTGATMSD DDDDQADSDT NLYDGGLDGA DYMGFGPLVP TETERSLMEH  240
VRKELKHELK QGYKEKIVDI REEILRKRRA GKLPGDTTSL LKAWWQSHSK WPYPTEEDKA  300
RLVQETGLQL KQINNWFINQ RKRNWHSNPS GSTTKSKRKK *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1320339RKRNWHSNPSGSTTKSKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015577480.10.0PREDICTED: homeobox protein knotted-1-like 3
SwissprotP480001e-166KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLB9SC320.0B9SC32_RICCO; Homeobox protein knotted-1, putative
STRINGPOPTR_0018s12200.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-156KNOTTED1-like homeobox gene 3